• Regulatory status:RUO
• Type:Polyclonal Antibody
• Other names:Adipocyte C1q and collagen domain-containing protein, Adipocyte complement-related 30 kDa protein, ACRP30, Adipose most abundant gene transcript 1 protein, apM-1, Gelatin-binding protein, ADIPOQ, ACDC, APM1, GBP28
• Species:Porcine

Type

Polyclonal Antibody

Applications

Western blotting

Source of Antigen

HEK293

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Porcine Adiponectin.

Amino Acid Sequence

Total 238 AA. MW: 26.0 kDa (calculated). N-Terminal Flag-tag, UniProtKB/TrEMBL Q6PP07 with 13 extra AA (highlighted).

HVDYKDDDDKPAGETTEKPGALLPMPKGACAGWMAGIPGHPGHNGTPGRDGRDGVPGEKGEKGDTGLTGPKGDTGESGVTGVEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLETRVTVPNMPIRFTKIFYNQQNHYDVTTGKFHCNIPGLYYFSFHITVYLKDVKVSLYKKDKAVLFTYDQYQDKNVDQASGSVLLYLEKGDQVWLQAYGDEENNGVYADNVNDSIFTGFLLYHNIE

Species Reactivity

Porcine. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant porcine Adiponectin.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibodySDS PAGE – to determine purity of the antibody

Note

This product is for research use only.