• Regulatory status:RUO
• Type:Recombinant
• Source:Chinese Hamster Ovary Cells (CHO)
• Other names:TNFSF7, CD70
• Species:Human

Type

Recombinant

Description

CD27 Ligand, a type II transmembrane protein, is a member of the TNF superfamily. It is expressed on activated T and B lymphocytes, as well as NK cells. CD27L and its receptor (CD27) regulate the immune response by promoting T-cell expansion and differentiation, as well as NK enhancement. CD27 signaling can act as a co-stimulatory effector to sustain the survival of CD8+ T cells, primarily by inducing increased expression of the IL-2 gene. Full length human CD27L is a 193 amino acid protein, consisting of a 17 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 155 amino acid extracellular domain. Human soluble CD27L corresponds to the 155 amino acid extracellular domain of the full length CD27L protein. PeproTech’s Re­combinant Human sCD27L contains the extracellular domain plus an N-terminal His-Tag. The calculated molecular weight of Recombinant Human sCD27L is 18.8 kDa.

Amino Acid Sequence

HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Source

Chinese Hamster Ovary Cells (CHO)

Purity

95%

Biological Activity

Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0–25.0 ng/ml. Note: Results may vary with PBMC donors.

Endotoxin

Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).

Reconstitution

Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1–1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at –20°C to –80°C

Storage/Expiration

 –20°C