
Product Name | Anti - BetaGamma (MPS - Phosducin - like protein C terminus)AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE |
Size | 0.5 mg |
Catalog # | AS-24177 |
US$ | $249 |
This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with Gβϒ-mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβγ, and inhibition of Gβγ-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins. | |
Detailed Information | ![]() ![]() |
Storage | -20°C |
References | 1, Orr, A. et al. J. Biol. Chem. 277, 20453 (2002) 2, Chang M. et al. J Biol Chem. 275:7021-7029 (2000). |
Molecular Weight | 4601.4 |
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE | |
Sequence(Three-Letter Code) | H - Ala - Ala - Val - Ala - Leu - Leu - Pro - Ala - Val - Leu - Leu - Ala - Leu - Leu - Ala - Val - Thr - Asp - Gln - Leu - Gly - Glu - Asp - Phe - Phe - Ala - Val - Asp - Leu - Glu - Ala - Phe - Leu - Gln - Glu - Phe - Gly - Leu - Leu - Pro - Glu - Lys - Glu - OH |
Product Citations | Morrey, C. et al. (2008). Cardioprotective effect of histamine H3-receptor activation: pivotal role of Gβγ-dependent inhibition of voltage-operated Ca2+ channels. J Pharmacol Exp Ther326, 871. doi: 10.1124/jpet.108.137919. Carlos, Talaia. et al. (2005). Interaction between adenosine A2B- receptors and α2-adrenoreceptors on the modulation of noradrenalin release in the rat vas deferens: Possible involvement of a group 2 adenylyl cyclase isoform. Neurochem Intl476, 418-429. doi: doi:10.1016/j.neuint.2005.05.013. Orr, A. et al. (2002). Thrombospondin Stimulates Focal Adhesion Disassembly through Gi- and Phosphoinositide 3-Kinase-dependent ERK Activation. J Biol Chem. 277, 20453.doi: 10.1074/jbc.M112091200. |
ebiomall.com






>
>
>
>
>
>
>
>
>
>
>
>

