
Human CD95 (APO-1/FAS) is a type I cell surface glycoprotein that is strongly upregulated on activated T cells, B cells, NK cells and thymocytes (1). CD95 plays an important role in programmed cell death or apoptosis (2). Apoptosis appears to be a mechanism for regulating the immune response (3, 4).
Molecular Structure: A soluble fusion protein consisting of the mature extracellular (159 aa) domain of human CD95 fused to a linker (4 aa) and human IgG1 Fc + hinge (232 aa), with a (non glycosylated) predicted monomeric molecular weight of 44.3 kd.
CD95(EC):
rlssksvnaqvtdinskglelrktvttvetqnleglhhdgqfchkpcppgerkardctvngdepdcvpcqegkeytdkahfsskcrrcrlcdeghgleveinctrtqntkcrckpnffcnstvcehcdpctkcehgiikectltsntkckeegsrsnlg
linker: gtyv
Human Ig Fc + hinge:
eprscdkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
Transfectant Cell Line: CHO
Functional Application: CD95-huIg fusion protein inhibits CD178 mediated apoptosis of Jurkat cells.
References:
1. Leukocyte Typing V (S.F. Schlossman, et al, eds.) Oxford University Press, Oxford (1995) p. 1142-1148.
2. S. Nagata & P. Golstein (1995) Science 267: 1449-1456.
3. S. Nagata & T. Suda (1995) Immunol Today 16: 39-43.
4. D.H. Lynch, F. Ramsdell & M.R. Alderson (1995) Immunol Today 16: 569-574.
5. H Wajant, (2003) Essays Biochem 39:53-71.
6. A. Ackery, M G Fehlings, (2006) J Neurotrauma 23(5): 604-616.
ebiomall.com






>
>
>
>
>
>
>
>
>
>
>
>

