LL-37
| LL-37 | Unit size | Cat. code | Docs | Price |
|---|---|---|---|---|
Antimicrobial peptide | 1 mg | tlrl-l37 | TDSMSDS | Please contact our distributor Add to favorite |
- About
- Specifications
- Contents
- Citations
- Related products
LL-37: Antimicrobial peptide
LL-37, also known as hCAP18, is the C-terminal part of the only human cathelicidin identified to date called human cationic antimicrobial protein (hCAP).
LL-37 exhibits a variety of immunomodulatory functions such as bactericidal action, chemotaxis, activation of chemokine secretion and antisepsis effect [1].The synthetic LL-37 peptide has been shown to suppress the inflammatory response induced by LPS and other TLR ligands [2].
References:
1. Scott MG. et al., 2002. The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses. J Immunol. 169(7):3883-91.2. Mookherjee N. et al., 2006. Modulation of theTLR-mediated inflammatory response by the endogenous human host defense peptide LL-37. J Immunol. 176(4):2455-64.
Back to the topSpecifications
Working concentration: 1 -50 µg/ml
Solubility: Water (1 mg/ml)
Amino acid sequence: [LL-37, 37 aa]
Molecular formula: C205H340N60O35
Molecular weight: 4493.37
Purity: ≥ 95 % (UHPLC)
Back to the topContents
LL-37 is provided lyophilized.
- 1 mg synthetic LL-37
- 1.5 ml endotoxin-free water
LL-37 is shipped at room temperature.
Store at -20°C.
Lyophilized product is stable 6 months when properly stored.
Citations
2020 J Invest Dermatol. DOI: 10.1016/j.jid.2019.09.029
RNase 7 promotes sensing of self-DNA by human keratinocytes and activates an antiviral immune response.
Kopfnagel V. et al.
2020 Nat Commun. DOI: 10.1038/s41467-019-13756-4
Neutrophil extracellular trap-associated RNA and LL37 enable self-amplifying inflammation in psoriasis.
Herster F. et al.
2019 Sci Rep.DOI: 10.1038/s41598-019-42751-4
Airway surface liquid acidification initiates host defense abnormalities in Cystic Fibrosis.
Simonin J. et al.
2019 Pathogens. DOI: 10.3390/pathogens8010031.
Differential Expression of Antimicrobial Peptides in Streptococcus pneumoniae Keratitis and STAT3-Dependent Expression of LL-37 by Streptococcus pneumoniae in Human Corneal Epithelial Cells.
Sharma P. et al.
2019 Viruses DOI: 10.3390/v11010077.
Comparison of Anti-Viral Activity of Frog Skin Anti-Microbial Peptides Temporin-Sha and [K³]SHa to LL-37 and Temporin-Tb against Herpes Simplex Virus Type 1.
Roy M. et al.
2019 Antiviral Res. DOI: 10.1016/j.antiviral.2018.07.025
LL-37 disrupts the Kaposi's sarcoma-associated herpesvirus envelope and inhibits infection in oral epithelial cells.
Brice D.C. et al.
2017 Dermatol Ther (Heidelb). DOI: 10.1007/s13555-017-0176-3
Topical Treatment of Rosacea with Ivermectin Inhibits Gene Expression of Cathelicidin Innate Immune Mediators, LL-37 and KLK5, in Reconstructed and Ex Vivo Skin.
Thibaut de Ménonville S. et al.
Load moreYou may also need
LPS-EB (LPS from E. coli O111:B4)TLR4 Agonist - Lipopolysaccharide from E. coli 0111:B4
Poly(I:C) HMWHigh molecular weight Polyinosine-polycytidylic acid
ebiomall.com
